Reta (GLP3-RT)
A synthetically engineered, multi-site peptide analog supplied as a lyophilized powder for use exclusively within qualified laboratory settings. Its biochemical properties continue to be evaluated for relevance to metabolic receptor signaling, endocrine research, and multi-agonist interaction models.
- Third party lab tested
- Guaranteed 99%+ purity
- Fast shipping
Product Usage: For Research Use Only — Not for Human or Veterinary Use
This product is not a drug, food, cosmetic, or dietary supplement and has not been evaluated by the FDA. It is strictly intended for in vitro research by qualified professionals. Any use in humans or animals is strictly prohibited and may violate federal, state, or local laws, including the Federal Food, Drug, and Cosmetic Act. No therapeutic or diagnostic application is implied or permitted. The purchaser assumes all responsibility for compliance with applicable regulations.
Product Name
Reta (GLP3-RT)
Chemical Information
- Molecular Formula
- C₂₂₁H₃₄₂N₄₆O₆₈
- Molecular Weight
- 4845.44 g/mol
- Sequence
- YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
Research Applications
Reta is employed in laboratory research for applications including, but not limited to:
- Computational and experimental receptor–ligand interaction modeling
- Assessment of synthetic conjugation and modification techniques in non-human systems
- Analysis of peptide stability, degradation pathways, and structural integrity
- Development and validation of receptor signaling models and screening assays
Storage & Handling
- Store lyophilized material at -20°C, protected from light.
- After reconstitution, store at 2–8°C and use within a short timeframe.
- Use aseptic technique and appropriate PPE during all handling.
All handling must comply with institutional safety procedures, including appropriate PPE and biosafety controls as dictated by facility policy and applicable regulations.
Product Specifications
- Purity
- ≥99% (HPLC verified)
- Form
- Lyophilized white to off-white powder
- Solubility
- Soluble in bacteriostatic water
Compliance Notice
Reta (GLP3-RT) is FOR RESEARCH USE ONLY and is not intended for human or veterinary use. This product has not been evaluated by the FDA and is not designed for therapeutic, diagnostic, or clinical purposes. Any use outside of legitimate in vitro research applications may be subject to regulatory action. By purchasing this product, the buyer acknowledges and agrees that it will be used exclusively for lawful research purposes.
